Recombinant Full Length Human CYP4A11 Protein, GST-tagged

• Cat.No.: CYP4A11-2440HF
• Product Overview: Human CYP4A11 full-length ORF ( AAH22851, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 49.39 kDa
• Protein length: 215 amino acids
• AA Sequence: MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYP4A11 cytochrome P450, family 4, subfamily A, polypeptide 11 [ Homo sapiens ]
• Official Symbol: CYP4A11
• Synonyms: CYP4A11; cytochrome P450, family 4, subfamily A, polypeptide 11; CYP4A2, cytochrome P450, subfamily IVA, polypeptide 11; cytochrome P450 4A11; CYP4AII; CYPIVA11; P450HL-omega; 20-HETE synthase; alkane-1 monooxygenase; cytochrome P450HL-omega; cytochrome P-450HK-omega; fatty acid omega-hydroxylase; lauric acid omega-hydroxylase; 20-hydroxyeicosatetraenoic acid synthase; cytochrome P450, subfamily IVA, polypeptide 11; CP4Y; CYP4A2
• Gene ID: 1579
• mRNA Refseq: NM_000778
• Protein Refseq: NP_000769
• MIM: 601310
• UniProt ID: Q02928