Recombinant Full Length Human CYP19A1 Protein, C-Flag-tagged
Cat.No. : | CYP19A1-1732HFL |
Product Overview : | Recombinant Full Length Human CYP19A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGI GSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPEL WKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRISLDE SAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFAT ELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDI QKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEM IFTPRNSDRCLEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, P450 |
Protein Pathways : | Androgen and estrogen metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | CYP19A1 cytochrome P450 family 19 subfamily A member 1 [ Homo sapiens (human) ] |
Official Symbol | CYP19A1 |
Synonyms | ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM |
Gene ID | 1588 |
mRNA Refseq | NM_000103.4 |
Protein Refseq | NP_000094.2 |
MIM | 107910 |
UniProt ID | P11511 |
◆ Recombinant Proteins | ||
CYP19A1-26393TH | Recombinant Human CYP19A1 | +Inquiry |
CYP19A1-1732HFL | Recombinant Full Length Human CYP19A1 Protein, C-Flag-tagged | +Inquiry |
CYP19A1-300H | Recombinant Human CYP19A1 protein, GST-tagged | +Inquiry |
CYP19A1-112HF | Recombinant Full Length Human CYP19A1 Protein | +Inquiry |
Cyp19a1-369R | Recombinant Rat Cyp19a1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP19A1-7127HCL | Recombinant Human CYP19A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP19A1 Products
Required fields are marked with *
My Review for All CYP19A1 Products
Required fields are marked with *
0
Inquiry Basket