Recombinant Full Length Human CYCS Protein, GST-tagged

• Cat.No.: CYCS-2400HF
• Product Overview: Human CYCS full-length ORF ( AAH05299, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 105 amino acids
• Description: This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]
• Molecular Mass: 37.29 kDa
• AA Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYCS cytochrome c, somatic [ Homo sapiens ]
• Official Symbol: CYCS
• Synonyms: CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4
• Gene ID: 54205
• mRNA Refseq: NM_018947
• Protein Refseq: NP_061820
• MIM: 123970
• UniProt ID: P99999