Recombinant Human CYCS protein, GST-tagged
Cat.No. : | CYCS-2782H |
Product Overview : | Recombinant Human CYCS protein(P99999)(2-105aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-105aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CYCS cytochrome c, somatic [ Homo sapiens ] |
Official Symbol | CYCS |
Synonyms | CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4; |
Gene ID | 54205 |
mRNA Refseq | NM_018947 |
Protein Refseq | NP_061820 |
MIM | 123970 |
UniProt ID | P99999 |
◆ Recombinant Proteins | ||
CYCS-2764H | Recombinant Human CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
CYCS-2120M | Recombinant Mouse CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
CYCS-1368R | Recombinant Rat CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
CYCS-4135M | Recombinant Mouse CYCS Protein | +Inquiry |
CYCS-2782H | Recombinant Human CYCS protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYCS-7135HCL | Recombinant Human CYCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYCS Products
Required fields are marked with *
My Review for All CYCS Products
Required fields are marked with *
0
Inquiry Basket