Recombinant Full Length Human CXCL3 Protein, GST-tagged

• Cat.No.: CXCL3-2288HF
• Product Overview: Human CXCL3 full-length ORF ( NP_002081.2, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 37.7 kDa
• Protein length: 107 amino acids
• AA Sequence: MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXCL3 chemokine (C-X-C motif) ligand 3 [ Homo sapiens ]
• Official Symbol: CXCL3
• Synonyms: CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b
• Gene ID: 2921
• mRNA Refseq: NM_002090
• Protein Refseq: NP_002081
• MIM: 139111
• UniProt ID: P19876