Recombinant Full Length Human CUL2 Protein, C-Flag-tagged
Cat.No. : | CUL2-1685HFL |
Product Overview : | Recombinant Full Length Human CUL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ubiquitin protein ligase binding activity. Predicted to be involved in SCF-dependent proteasomal ubiquitin-dependent protein catabolic process and protein ubiquitination. Predicted to act upstream of or within protein catabolic process. Located in nucleoplasm. Part of Cul2-RING ubiquitin ligase complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 86.8 kDa |
AA Sequence : | MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVR HLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIG ELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESP FLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHA ECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKF VQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKF NNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLC TGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKE DIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALI QEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | CUL2 cullin 2 [ Homo sapiens (human) ] |
Official Symbol | CUL2 |
Synonyms | MGC131970 |
Gene ID | 8453 |
mRNA Refseq | NM_003591.4 |
Protein Refseq | NP_003582.2 |
MIM | 603135 |
UniProt ID | Q13617 |
◆ Recombinant Proteins | ||
CRYGC-2971H | Recombinant Human CRYGC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DIRAS1-2817H | Recombinant Human DIRAS1, His-tagged | +Inquiry |
ATP8B1-5137C | Recombinant Chicken ATP8B1 | +Inquiry |
RFL20113BF | Recombinant Full Length Bovine Proteolipid Protein 2(Plp2) Protein, His-Tagged | +Inquiry |
RTN4R-840H | Recombinant Human RTN4R protein, His&hFc-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-312H | Native Human LTF protein | +Inquiry |
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
Collagen Type I-524B | Native Bovine Collagen Type I Protein, FITC-conjugated | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
Lysostaphin-91S | Active Native Staphylococcus staphylolyticus Lysostaphin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABGGTB-2572HCL | Recombinant Human RABGGTB 293 Cell Lysate | +Inquiry |
SCIN-1568HCL | Recombinant Human SCIN cell lysate | +Inquiry |
UBOX5-549HCL | Recombinant Human UBOX5 293 Cell Lysate | +Inquiry |
KIAA0513-4973HCL | Recombinant Human KIAA0513 293 Cell Lysate | +Inquiry |
FHL5-6221HCL | Recombinant Human FHL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUL2 Products
Required fields are marked with *
My Review for All CUL2 Products
Required fields are marked with *
0
Inquiry Basket