Recombinant Full Length Human CTSZ Protein
Cat.No. : | CTSZ-101HF |
Product Overview : | Recombinant full length Human Cathepsin Z with a N terminal proprietary tag. Predicted MW 59.40kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 303 amino acids |
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. |
Form : | Liquid |
Molecular Mass : | 59.400kDa inclusive of tags |
AA Sequence : | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGD GLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASIT RNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAK DQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGRE KMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CTSZ cathepsin Z [ Homo sapiens ] |
Official Symbol | CTSZ |
Synonyms | CTSZ; cathepsin Z; CTSX |
Gene ID | 1522 |
mRNA Refseq | NM_001336 |
Protein Refseq | NP_001327 |
MIM | 603169 |
UniProt ID | Q9UBR2 |
◆ Recombinant Proteins | ||
SPINK4-934M | Recombinant Mouse SPINK4 Protein, Fc-tagged | +Inquiry |
PIM2-29589TH | Recombinant Human PIM2 | +Inquiry |
SLC1A3A-11917Z | Recombinant Zebrafish SLC1A3A | +Inquiry |
PSCA-2002H | Recombinant Human PSCA protein, His-tagged | +Inquiry |
CPT-PHAGEK-GP011-6245S | Recombinant Staphylococcus phage K CPT_PHAGEK_GP011 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
LDH-216S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
COL3A1-18B | Native Bovine COL3A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPRHL1-9002HCL | Recombinant Human ADPRHL1 293 Cell Lysate | +Inquiry |
Colon-750B | Bovine Colon Membrane Lysate, Total Protein | +Inquiry |
ALPP-8893HCL | Recombinant Human ALPP 293 Cell Lysate | +Inquiry |
PTPN22-2684HCL | Recombinant Human PTPN22 293 Cell Lysate | +Inquiry |
EIF1-6679HCL | Recombinant Human EIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CTSZ Products
Required fields are marked with *
My Review for All CTSZ Products
Required fields are marked with *
0
Inquiry Basket