Recombinant Full Length Human CSTF2 Protein, C-Flag-tagged
Cat.No. : | CSTF2-267HFL |
Product Overview : | Recombinant Full Length Human CSTF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.8 kDa |
AA Sequence : | MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR QSILILKEQIQKSTGAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CSTF2 cleavage stimulation factor subunit 2 [ Homo sapiens (human) ] |
Official Symbol | CSTF2 |
Synonyms | CstF-64 |
Gene ID | 1478 |
mRNA Refseq | NM_001325.3 |
Protein Refseq | NP_001316.1 |
MIM | 300907 |
UniProt ID | P33240 |
◆ Recombinant Proteins | ||
SPART-3930H | Recombinant Human SPART Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KIT-89H | Active Recombinant Human c-KIT Mutant (V559D T670I), GST-tagged | +Inquiry |
CDCA8-3159M | Recombinant Mouse CDCA8 Protein | +Inquiry |
EFCAB1-12298H | Recombinant Human EFCAB1, GST-tagged | +Inquiry |
UPK3A-2498M | Recombinant Mouse UPK3A Protein (19-207 aa), His-Myc-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
Neuraminidase-009C | Active Native Clostridium perfringens Neuraminidase, Type VIII | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2-3068HCL | Recombinant Human C2 cell lysate | +Inquiry |
HIST1H3F-5530HCL | Recombinant Human HIST1H3F 293 Cell Lysate | +Inquiry |
PTK7-2697HCL | Recombinant Human PTK7 293 Cell Lysate | +Inquiry |
RPGR-2234HCL | Recombinant Human RPGR 293 Cell Lysate | +Inquiry |
RGR-2387HCL | Recombinant Human RGR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSTF2 Products
Required fields are marked with *
My Review for All CSTF2 Products
Required fields are marked with *
0
Inquiry Basket