Recombinant Full Length Human CSTF2 Protein, C-Flag-tagged
Cat.No. : | CSTF2-267HFL |
Product Overview : | Recombinant Full Length Human CSTF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.8 kDa |
AA Sequence : | MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR QSILILKEQIQKSTGAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CSTF2 cleavage stimulation factor subunit 2 [ Homo sapiens (human) ] |
Official Symbol | CSTF2 |
Synonyms | CstF-64 |
Gene ID | 1478 |
mRNA Refseq | NM_001325.3 |
Protein Refseq | NP_001316.1 |
MIM | 300907 |
UniProt ID | P33240 |
◆ Recombinant Proteins | ||
CSTF2-4005M | Recombinant Mouse CSTF2 Protein | +Inquiry |
CSTF2-1574C | Recombinant Chicken CSTF2 | +Inquiry |
CSTF2-267HFL | Recombinant Full Length Human CSTF2 Protein, C-Flag-tagged | +Inquiry |
CSTF2-676H | Recombinant Human CSTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSTF2-2249HF | Recombinant Full Length Human CSTF2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSTF2-414HCL | Recombinant Human CSTF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSTF2 Products
Required fields are marked with *
My Review for All CSTF2 Products
Required fields are marked with *
0
Inquiry Basket