Recombinant Full Length Human CSRP1 Protein

• Cat.No.: CSRP1-98HF
• Product Overview: Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 193 amino acids
• Description: This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.
• Form: Liquid
• Molecular Mass: 47.300kDa inclusive of tags
• AA Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
• Official Symbol: CSRP1
• Synonyms: CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E
• Gene ID: 1465
• mRNA Refseq: NM_001193570
• Protein Refseq: NP_001180499
• MIM: 123876
• UniProt ID: P21291