Recombinant Full Length Human CSRP1 Protein
Cat.No. : | CSRP1-98HF |
Product Overview : | Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 193 amino acids |
Description : | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. |
Form : | Liquid |
Molecular Mass : | 47.300kDa inclusive of tags |
AA Sequence : | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ] |
Official Symbol | CSRP1 |
Synonyms | CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E |
Gene ID | 1465 |
mRNA Refseq | NM_001193570 |
Protein Refseq | NP_001180499 |
MIM | 123876 |
UniProt ID | P21291 |
◆ Recombinant Proteins | ||
CSRP1-3085H | Recombinant Human CSRP1 protein(Met1-Glu193), His-tagged | +Inquiry |
CSRP1-891R | Recombinant Rhesus Macaque CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-2030M | Recombinant Mouse CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-1066R | Recombinant Rhesus monkey CSRP1 Protein, His-tagged | +Inquiry |
CSRP1-1234HFL | Recombinant Full Length Human CSRP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSRP1 Products
Required fields are marked with *
My Review for All CSRP1 Products
Required fields are marked with *
0
Inquiry Basket