Recombinant Full Length Human CSRP1 Protein, C-Flag-tagged
Cat.No. : | CSRP1-1234HFL |
Product Overview : | Recombinant Full Length Human CSRP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CSRP1 cysteine and glycine rich protein 1 [ Homo sapiens (human) ] |
Official Symbol | CSRP1 |
Synonyms | CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286 |
Gene ID | 1465 |
mRNA Refseq | NM_004078.3 |
Protein Refseq | NP_004069.1 |
MIM | 123876 |
UniProt ID | P21291 |
◆ Recombinant Proteins | ||
CSRP1-2030M | Recombinant Mouse CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-6800C | Recombinant Chicken CSRP1 | +Inquiry |
CSRP1-3990M | Recombinant Mouse CSRP1 Protein | +Inquiry |
CSRP1-2216HF | Recombinant Full Length Human CSRP1 Protein, GST-tagged | +Inquiry |
CSRP1-1641R | Recombinant Rat CSRP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSRP1 Products
Required fields are marked with *
My Review for All CSRP1 Products
Required fields are marked with *
0
Inquiry Basket