Recombinant Full Length Human CREM Protein, GST-tagged
Cat.No. : | CREM-2296HF |
Product Overview : | Human CREM full-length ORF ( NP_001872.3, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 137 amino acids |
Description : | This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 41.3 kDa |
AA Sequence : | MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CREM cAMP responsive element modulator [ Homo sapiens ] |
Official Symbol | CREM |
Synonyms | CREM; cAMP responsive element modulator; cAMP-responsive element modulator; hCREM 2; CREM 2beta-a protein; CREM 2alpha-b protein; cAMP response element modulator; inducible cAMP early repressor ICER; ICER; CREM-2; hCREM-2; MGC17881; MGC41893; MGC111110; |
Gene ID | 1390 |
mRNA Refseq | NM_001881 |
Protein Refseq | NP_001872 |
MIM | 123812 |
UniProt ID | Q03060 |
◆ Recombinant Proteins | ||
CREM-3330H | Recombinant Human CREM Protein, His-tagged | +Inquiry |
CREM-5957C | Recombinant Chicken CREM | +Inquiry |
CREM-5384C | Recombinant Chicken CREM | +Inquiry |
CREM-2296HF | Recombinant Full Length Human CREM Protein, GST-tagged | +Inquiry |
CREM-840H | Recombinant Human CREM Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREM-7283HCL | Recombinant Human CREM 293 Cell Lysate | +Inquiry |
CREM-7285HCL | Recombinant Human CREM 293 Cell Lysate | +Inquiry |
CREM-7284HCL | Recombinant Human CREM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CREM Products
Required fields are marked with *
My Review for All CREM Products
Required fields are marked with *
0
Inquiry Basket