Recombinant Full Length Human CREM Protein, GST-tagged

• Cat.No.: CREM-2296HF
• Product Overview: Human CREM full-length ORF ( NP_001872.3, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.3 kDa
• Protein length: 137 amino acids
• AA Sequence: MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CREM cAMP responsive element modulator [ Homo sapiens ]
• Official Symbol: CREM
• Synonyms: CREM; cAMP responsive element modulator; cAMP-responsive element modulator; hCREM 2; CREM 2beta-a protein; CREM 2alpha-b protein; cAMP response element modulator; inducible cAMP early repressor ICER; ICER; CREM-2; hCREM-2; MGC17881; MGC41893; MGC111110
• Gene ID: 1390
• mRNA Refseq: NM_001881
• Protein Refseq: NP_001872
• MIM: 123812
• UniProt ID: Q03060