Recombinant Full Length Human CPNE6 Protein, C-Flag-tagged
Cat.No. : | CPNE6-1721HFL |
Product Overview : | Recombinant Full Length Human CPNE6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the copine family. Members of this family are calcium-dependent, phospholipid-binding proteins with C2 domains, two calcium- and phospholipid-binding domains. Through their domain structure and lipid binding capabilities, these proteins may play a role in membrane trafficking. This protein is thought to be brain-specific and has a domain structure of two N-terminal C2 domains and one von Willebrand factor A domain. It may have a role in synaptic plasticity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MSDPEMGWVPEPQTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERTEVLRSCSSPV FSRVLALEYFFEEKQPVQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQTKVTKPLLLKNGKTAGKSTI TIVAEEVSGTNDYVQLTFRAYKLDNKDLFSKSDPFMEIYKTNEDQSDQLVWRTEVVKNNLNPSWEPFRLS LHSLCSCDVHRPLKFLVYDYDSSGKHDFIGEFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSG TVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQD YDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA EPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLR CPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTLATTPSPSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CPNE6 copine 6 [ Homo sapiens (human) ] |
Official Symbol | CPNE6 |
Synonyms | N-COPINE |
Gene ID | 9362 |
mRNA Refseq | NM_006032.4 |
Protein Refseq | NP_006023.1 |
MIM | 605688 |
UniProt ID | O95741 |
◆ Recombinant Proteins | ||
CPNE6-1721HFL | Recombinant Full Length Human CPNE6 Protein, C-Flag-tagged | +Inquiry |
CPNE6-1936M | Recombinant Mouse CPNE6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPNE6-3311H | Recombinant Human CPNE6 Protein, MYC/DDK-tagged | +Inquiry |
CPNE6-1802H | Recombinant Human CPNE6 Protein, GST-tagged | +Inquiry |
Cpne6-935M | Recombinant Mouse Cpne6 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPNE6-196HCL | Recombinant Human CPNE6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPNE6 Products
Required fields are marked with *
My Review for All CPNE6 Products
Required fields are marked with *
0
Inquiry Basket