Recombinant Full Length Human COX11 Protein, GST-tagged

• Cat.No.: COX11-1993HF
• Product Overview: Human COX11 full-length ORF ( NP_004366.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 276 amino acids
• Description: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6. [provided by RefSeq, Jun 2009]
• Molecular Mass: 57.8 kDa
• AA Sequence: MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX11 COX11 cytochrome c oxidase assembly homolog (yeast) [ Homo sapiens ]
• Official Symbol: COX11
• Synonyms: COX11; COX11 cytochrome c oxidase assembly homolog (yeast); COX11 (yeast) homolog, cytochrome c oxidase assembly protein; cytochrome c oxidase assembly protein COX11, mitochondrial; COX11P; cytochrome c oxidase assembly protein COX11; cytochrome c oxidase subunit 11; COX11 homolog, cytochrome c oxidase assembly protein
• Gene ID: 1353
• mRNA Refseq: NM_001162861
• Protein Refseq: NP_001156333
• MIM: 603648
• UniProt ID: Q9Y6N1