Recombinant Full Length Human COQ9 Protein, GST-tagged

• Cat.No.: COQ9-1979HF
• Product Overview: Human COQ9 full-length ORF (AAH64946.1, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 61.38 kDa
• Protein length: 318 amino acids
• AA Sequence: MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COQ9 coenzyme Q9 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: COQ9
• Synonyms: COQ9; coenzyme Q9 homolog (S. cerevisiae); C16orf49, chromosome 16 open reading frame 49 , coenzyme Q9 homolog (yeast); ubiquinone biosynthesis protein COQ9, mitochondrial; DKFZP434K046; C16orf49; DKFZp434K046
• Gene ID: 57017
• mRNA Refseq: NM_020312
• Protein Refseq: NP_064708
• MIM: 612837
• UniProt ID: O75208