Recombinant Full Length Human COQ9 Protein, GST-tagged

Cat.No. : COQ9-1979HF
Product Overview : Human COQ9 full-length ORF (AAH64946.1, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 318 amino acids
Description : This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010]
Molecular Mass : 61.38 kDa
AA Sequence : MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COQ9 coenzyme Q9 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol COQ9
Synonyms COQ9; coenzyme Q9 homolog (S. cerevisiae); C16orf49, chromosome 16 open reading frame 49 , coenzyme Q9 homolog (yeast); ubiquinone biosynthesis protein COQ9, mitochondrial; DKFZP434K046; C16orf49; DKFZp434K046
Gene ID 57017
mRNA Refseq NM_020312
Protein Refseq NP_064708
MIM 612837
UniProt ID O75208

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COQ9 Products

Required fields are marked with *

My Review for All COQ9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon