Recombinant Human COQ9 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: COQ9-196H
• Product Overview: COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency. [provided by RefSeq, Sep 2010]
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 35.5 kDa
• AA Sequence: MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COQ9 coenzyme Q9 homolog (S. cerevisiae) [ Homo sapiens (human) ]
• Official Symbol: COQ9
• Synonyms: COQ9; coenzyme Q9 homolog (S. cerevisiae); C16orf49, chromosome 16 open reading frame 49, coenzyme Q9 homolog (yeast); ubiquinone biosynthesis protein COQ9, mitochondrial; DKFZP434K046; C16orf49; DKFZp434K046
• Gene ID: 57017
• mRNA Refseq: NM_020312
• Protein Refseq: NP_064708
• MIM: 612837
• UniProt ID: O75208