Recombinant Human COQ9 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : COQ9-196H
Product Overview : COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency. [provided by RefSeq, Sep 2010]
Molecular Mass : 35.5 kDa
AA Sequence : MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COQ9 coenzyme Q9 homolog (S. cerevisiae) [ Homo sapiens (human) ]
Official Symbol COQ9
Synonyms COQ9; coenzyme Q9 homolog (S. cerevisiae); C16orf49, chromosome 16 open reading frame 49, coenzyme Q9 homolog (yeast); ubiquinone biosynthesis protein COQ9, mitochondrial; DKFZP434K046; C16orf49; DKFZp434K046;
Gene ID 57017
mRNA Refseq NM_020312
Protein Refseq NP_064708
MIM 612837
UniProt ID O75208

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COQ9 Products

Required fields are marked with *

My Review for All COQ9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon