Recombinant Human COQ9 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | COQ9-196H |
Product Overview : | COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COQ9 coenzyme Q9 homolog (S. cerevisiae) [ Homo sapiens (human) ] |
Official Symbol | COQ9 |
Synonyms | COQ9; coenzyme Q9 homolog (S. cerevisiae); C16orf49, chromosome 16 open reading frame 49, coenzyme Q9 homolog (yeast); ubiquinone biosynthesis protein COQ9, mitochondrial; DKFZP434K046; C16orf49; DKFZp434K046; |
Gene ID | 57017 |
mRNA Refseq | NM_020312 |
Protein Refseq | NP_064708 |
MIM | 612837 |
UniProt ID | O75208 |
◆ Recombinant Proteins | ||
COQ9-1200R | Recombinant Rat COQ9 Protein, His (Fc)-Avi-tagged | +Inquiry |
COQ9-3795M | Recombinant Mouse COQ9 Protein | +Inquiry |
COQ9-5707Z | Recombinant Zebrafish COQ9 | +Inquiry |
COQ9-1979HF | Recombinant Full Length Human COQ9 Protein, GST-tagged | +Inquiry |
COQ9-1901M | Recombinant Mouse COQ9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COQ9-7346HCL | Recombinant Human COQ9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COQ9 Products
Required fields are marked with *
My Review for All COQ9 Products
Required fields are marked with *
0
Inquiry Basket