Recombinant Full Length Human COPS8 Protein, GST-tagged

Cat.No. : COPS8-1970HF
Product Overview : Human COPS8 full-length ORF ( AAH03090, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 209 amino acids
Description : The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Molecular Mass : 48.73 kDa
AA Sequence : MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COPS8 COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) [ Homo sapiens ]
Official Symbol COPS8
Synonyms COPS8; COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis); COP9 signalosome complex subunit 8; COP9; CSN8; MGC1297; SGN8; hCOP9; COP9 homolog; signalosome subunit 8; JAB1-containing signalosome subunit 8; MGC43256
Gene ID 10920
mRNA Refseq NM_006710
Protein Refseq NP_006701
MIM 616011
UniProt ID Q99627

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COPS8 Products

Required fields are marked with *

My Review for All COPS8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon