Recombinant Full Length Human CNOT7 Protein, C-Flag-tagged
Cat.No. : | CNOT7-358HFL |
Product Overview : | Recombinant Full Length Human CNOT7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.6 kDa |
AA Sequence : | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE ANKQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | RNA degradation |
Full Length : | Full L. |
Gene Name | CNOT7 CCR4-NOT transcription complex subunit 7 [ Homo sapiens (human) ] |
Official Symbol | CNOT7 |
Synonyms | CAF1; CAF-1; Caf1a; hCAF-1 |
Gene ID | 29883 |
mRNA Refseq | NM_013354.7 |
Protein Refseq | NP_037486.2 |
MIM | 604913 |
UniProt ID | Q9UIV1 |
◆ Recombinant Proteins | ||
Cnot7-3640R | Recombinant Mouse Cnot7, His-tagged | +Inquiry |
CNOT7-1941HF | Recombinant Full Length Human CNOT7 Protein, GST-tagged | +Inquiry |
CNOT7-941R | Recombinant Rhesus monkey CNOT7 Protein, His-tagged | +Inquiry |
CNOT7-1587H | Recombinant Human CNOT7 Protein, GST-tagged | +Inquiry |
CNOT7-1793H | Recombinant Human CNOT7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT7-7399HCL | Recombinant Human CNOT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNOT7 Products
Required fields are marked with *
My Review for All CNOT7 Products
Required fields are marked with *
0
Inquiry Basket