Recombinant Full Length Human CNN3 Protein, GST-tagged

• Cat.No.: CNN3-1930HF
• Product Overview: Human CNN3 full-length ORF ( NP_001830.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 62.8 kDa
• Protein length: 329 amino acids
• AA Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNN3 calponin 3, acidic [ Homo sapiens ]
• Official Symbol: CNN3
• Synonyms: CNN3; calponin 3, acidic; calponin-3; calponin, acidic isoform; dJ639P13.2.2 (acidic calponin 3)
• Gene ID: 1266
• mRNA Refseq: NM_001839
• Protein Refseq: NP_001830
• MIM: 602374
• UniProt ID: Q15417