Recombinant Full Length Human CNIH3 Protein, GST-tagged

Cat.No. : CNIH3-1925HF
Product Overview : Human CNIH3 full-length ORF ( AAH22780, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CNIH3 (Cornichon Family AMPA Receptor Auxiliary Protein 3) is a Protein Coding gene. Among its related pathways are Transport to the Golgi and subsequent modification and Vesicle-mediated transport. GO annotations related to this gene include channel regulator activity. An important paralog of this gene is CNIH2.
Molecular Mass : 43.34 kDa
Protein length : 160 amino acids
AA Sequence : MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNIH3 cornichon homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol CNIH3
Synonyms CNIH3; cornichon homolog 3 (Drosophila); protein cornichon homolog 3; CNIH 3; FLJ38993; CNIH-3
Gene ID 149111
mRNA Refseq NM_152495
Protein Refseq NP_689708
UniProt ID Q8TBE1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CNIH3 Products

Required fields are marked with *

My Review for All CNIH3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon