Description :	CNIH3 (Cornichon Family AMPA Receptor Auxiliary Protein 3) is a Protein Coding gene. Among its related pathways are Transport to the Golgi and subsequent modification and Vesicle-mediated transport. GO annotations related to this gene include channel regulator activity. An important paralog of this gene is CNIH2.
Molecular Mass :	43.34 kDa
AA Sequence :	MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CNIH3 cornichon homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol	CNIH3
Synonyms	CNIH3; cornichon homolog 3 (Drosophila); protein cornichon homolog 3; CNIH 3; FLJ38993; CNIH-3;
Gene ID	149111
mRNA Refseq	NM_152495
Protein Refseq	NP_689708
UniProt ID	Q8TBE1