Recombinant Human CNIH3 Protein, GST-tagged

• Cat.No.: CNIH3-1561H
• Product Overview: Human CNIH3 full-length ORF ( AAH22780, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CNIH3 (Cornichon Family AMPA Receptor Auxiliary Protein 3) is a Protein Coding gene. Among its related pathways are Transport to the Golgi and subsequent modification and Vesicle-mediated transport. GO annotations related to this gene include channel regulator activity. An important paralog of this gene is CNIH2.
• Molecular Mass: 43.34 kDa
• AA Sequence: MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNIH3 cornichon homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: CNIH3
• Synonyms: CNIH3; cornichon homolog 3 (Drosophila); protein cornichon homolog 3; CNIH 3; FLJ38993; CNIH-3
• Gene ID: 149111
• mRNA Refseq: NM_152495
• Protein Refseq: NP_689708
• UniProt ID: Q8TBE1