Recombinant Full Length Human CMSS1 Protein, GST-tagged

• Cat.No.: CMSS1-3252HF
• Product Overview: Human C3orf26 full-length ORF (NP_115735.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CMSS1 (Cms1 Ribosomal Small Subunit Homolog (Yeast)) is a Protein Coding gene. Diseases associated with CMSS1 include Refractive Error. GO annotations related to this gene include nucleic acid binding and poly(A) RNA binding.
• Molecular Mass: 58.2 kDa
• Protein length: 279 amino acids
• AA Sequence: MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMSS1 cms1 ribosomal small subunit homolog (yeast) [ Homo sapiens (human) ]
• Official Symbol: CMSS1
• Synonyms: CMSS1; cms1 ribosomal small subunit homolog (yeast)
• Gene ID: 84319
• mRNA Refseq: NM_032359
• Protein Refseq: NP_115735
• UniProt ID: Q9BQ75