Recombinant Full Length Human CMA1 Protein, GST-tagged
Cat.No. : | CMA1-1898HF |
Product Overview : | Human CMA1 full-length ORF (NP_001827.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 247 amino acids |
Description : | This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. [provided by RefSeq, Apr 2015] |
Molecular Mass : | 53.57 kDa |
AA Sequence : | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMA1 chymase 1, mast cell [ Homo sapiens ] |
Official Symbol | CMA1 |
Synonyms | CMA1; chymase 1, mast cell; chymase; alpha-chymase; chymase, heart; chymase, mast cell; mast cell protease I; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; CYH; MCT1; MGC119890; MGC119891 |
Gene ID | 1215 |
mRNA Refseq | NM_001836 |
Protein Refseq | NP_001827 |
MIM | 118938 |
UniProt ID | P23946 |
◆ Recombinant Proteins | ||
CMA1-2503H | Recombinant Human CMA1 protein, His-tagged | +Inquiry |
CMA1-1364D | Recombinant Dog CMA1 Protein (22-249 aa), His-tagged | +Inquiry |
CMA1-25H | Active Recombinant Human CMA1 protein, His-tagged | +Inquiry |
CMA1-11359H | Recombinant Human CMA1, GST-tagged | +Inquiry |
Cma1-509R | Recombinant Rat Cma1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMA1-493HCL | Recombinant Human CMA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMA1 Products
Required fields are marked with *
My Review for All CMA1 Products
Required fields are marked with *
0
Inquiry Basket