Recombinant Dog CMA1 Protein (22-249 aa), His-tagged

• Cat.No.: CMA1-1364D
• Product Overview: Recombinant Dog CMA1 Protein (22-249 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Dog
• Source: Yeast
• Tag: His
• Protein Length: 22-249 aa
• Description: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.5 kDa
• AA Sequence: IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CMA1 chymase 1, mast cell [ Homo sapiens ]
• Official Symbol: CMA1
• Synonyms: CMA1; chymase; CYH; MCT1; MGC119890; MGC119891
• Gene ID: 1215
• mRNA Refseq: NM_001836
• Protein Refseq: NP_001827
• MIM: 118938
• UniProt ID: P21842