Recombinant Full Length Human CLIC4 Protein, GST-tagged

Cat.No. : CLIC4-2184HF
Product Overview : Human CLIC4 full-length ORF (BAG37528.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 253 amino acids
Description : Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
Molecular Mass : 54.23 kDa
AA Sequence : MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLIC4 chloride intracellular channel 4 [ Homo sapiens ]
Official Symbol CLIC4
Synonyms CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1; chloride intracellular channel 4 like; intracellular chloride ion channel protein p64H1; MTCLIC; FLJ38640; DKFZp566G223
Gene ID 25932
mRNA Refseq NM_013943
Protein Refseq NP_039234
MIM 606536
UniProt ID Q9Y696

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLIC4 Products

Required fields are marked with *

My Review for All CLIC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon