Recombinant Full Length Human CLEC4E Protein, C-Flag-tagged
Cat.No. : | CLEC4E-679HFL |
Product Overview : | Recombinant Full Length Human CLEC4E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI NPLNKGKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | CLEC4E C-type lectin domain family 4 member E [ Homo sapiens (human) ] |
Official Symbol | CLEC4E |
Synonyms | MINCLE; CLECSF9 |
Gene ID | 26253 |
mRNA Refseq | NM_014358.4 |
Protein Refseq | NP_055173.1 |
MIM | 609962 |
UniProt ID | Q9ULY5 |
◆ Recombinant Proteins | ||
CLEC4E-2160HF | Recombinant Full Length Human CLEC4E Protein, GST-tagged | +Inquiry |
CLEC4E-7776H | Recombinant Human CLEC4E, His-tagged | +Inquiry |
CLEC4E-679HFL | Recombinant Full Length Human CLEC4E Protein, C-Flag-tagged | +Inquiry |
CLEC4E-2109H | Recombinant Human CLEC4E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLEC4E-1102R | Recombinant Rat CLEC4E Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4E-7450HCL | Recombinant Human CLEC4E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4E Products
Required fields are marked with *
My Review for All CLEC4E Products
Required fields are marked with *
0
Inquiry Basket