Recombinant Full Length Human CLEC2D Protein, GST-tagged

• Cat.No.: CLEC2D-2133HF
• Product Overview: Human CLEC2D full-length ORF ( AAH19883, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.68 kDa
• Protein length: 154 amino acids
• AA Sequence: MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC2D C-type lectin domain family 2, member D [ Homo sapiens ]
• Official Symbol: CLEC2D
• Synonyms: CLEC2D; C-type lectin domain family 2, member D; C type lectin superfamily 2, member D; C-type lectin domain family 2 member D; C type lectin related f; CLAX; lectin like transcript 1; LLT1; OCIL; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D
• Gene ID: 29121
• mRNA Refseq: NM_001004419
• Protein Refseq: NP_001004419
• MIM: 605659
• UniProt ID: Q9UHP7