Recombinant Full Length Human CIDEB Protein, GST-tagged

• Cat.No.: CIDEB-1849HF
• Product Overview: Human CIDEB full-length ORF ( AAH35970, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 219 amino acids
• Description: CIDEB (Cell Death-Inducing DFFA-Like Effector B) is a Protein Coding gene. GO annotations related to this gene include identical protein binding. An important paralog of this gene is CIDEC.
• Molecular Mass: 49.83 kDa
• AA Sequence: MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CIDEB cell death-inducing DFFA-like effector b [ Homo sapiens ]
• Official Symbol: CIDEB
• Synonyms: CIDEB; cell death-inducing DFFA-like effector b; cell death activator CIDE-B
• Gene ID: 27141
• mRNA Refseq: NM_014430
• Protein Refseq: NP_055245
• MIM: 604441
• UniProt ID: Q9UHD4