Recombinant Human CIDEB Protein, GST-tagged

Cat.No. : CIDEB-1362H
Product Overview : Human CIDEB full-length ORF ( AAH35970, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CIDEB (Cell Death-Inducing DFFA-Like Effector B) is a Protein Coding gene. GO annotations related to this gene include identical protein binding. An important paralog of this gene is CIDEC.
Molecular Mass : 49.83 kDa
AA Sequence : MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CIDEB cell death-inducing DFFA-like effector b [ Homo sapiens ]
Official Symbol CIDEB
Synonyms CIDEB; cell death-inducing DFFA-like effector b; cell death activator CIDE-B;
Gene ID 27141
mRNA Refseq NM_014430
Protein Refseq NP_055245
MIM 604441
UniProt ID Q9UHD4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CIDEB Products

Required fields are marked with *

My Review for All CIDEB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon