Recombinant Full Length Human CHTOP Protein, GST-tagged

Cat.No. : CHTOP-1836HF
Product Overview : Human CHTOP full-length ORF ( NP_056422.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 248 amino acids
Description : This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015]
Molecular Mass : 52.8 kDa
AA Sequence : MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHTOP chromatin target of PRMT1 [ Homo sapiens ]
Official Symbol CHTOP
Synonyms CHTOP; chromatin target of PRMT1; C1orf77, chromosome 1 open reading frame 77; chromatin target of PRMT1 protein; DKFZP547E1010; FOP; Friend of Prmt1; small protein rich in arginine and glycine; SRAG; friend of PRMT1 protein; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG; RP1-178F15.2; FLJ40551; MGC86949; MGC131924; DKFZp547E1010
Gene ID 26097
mRNA Refseq NM_001206612
Protein Refseq NP_001193541
MIM 614206
UniProt ID Q9Y3Y2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHTOP Products

Required fields are marked with *

My Review for All CHTOP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon