Recombinant Human CHTOP Protein, GST-tagged

• Cat.No.: CHTOP-1350H
• Product Overview: Human CHTOP full-length ORF ( NP_056422.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015]
• Molecular Mass: 52.8 kDa
• AA Sequence: MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHTOP chromatin target of PRMT1 [ Homo sapiens ]
• Official Symbol: CHTOP
• Synonyms: CHTOP; chromatin target of PRMT1; C1orf77, chromosome 1 open reading frame 77; chromatin target of PRMT1 protein; DKFZP547E1010; FOP; Friend of Prmt1; small protein rich in arginine and glycine; SRAG; friend of PRMT1 protein; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG; RP1-178F15.2; FLJ40551; MGC86949; MGC131924; DKFZp547E1010
• Gene ID: 26097
• mRNA Refseq: NM_001206612
• Protein Refseq: NP_001193541
• MIM: 614206
• UniProt ID: Q9Y3Y2