Recombinant Human CHTOP protein, GST-tagged

• Cat.No.: CHTOP-1862H
• Product Overview: Recombinant Human CHTOP protein(1 - 118 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1 - 118 aa
• AA Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CHTOP chromatin target of PRMT1 [ Homo sapiens ]
• Official Symbol: CHTOP
• Synonyms: CHTOP; chromatin target of PRMT1; C1orf77, chromosome 1 open reading frame 77; chromatin target of PRMT1 protein; DKFZP547E1010; FOP; Friend of Prmt1; small protein rich in arginine and glycine; SRAG; friend of PRMT1 protein; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG; RP1-178F15.2; FLJ40551; MGC86949; MGC131924; DKFZp547E1010
• Gene ID: 26097
• mRNA Refseq: NM_001206612
• Protein Refseq: NP_001193541
• MIM: 614206
• UniProt ID: Q9Y3Y2