Recombinant Full Length Human CHPT1 Protein, GST-tagged

Cat.No. : CHPT1-3217HF
Product Overview : Human CHPT1 full-length ORF (NP_064629.2, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 406 amino acids
Description : CHPT1 (Choline Phosphotransferase 1) is a Protein Coding gene. Among its related pathways are phosphatidylcholine biosynthesis and Synthesis of PC. GO annotations related to this gene include diacylglycerol binding and diacylglycerol cholinephosphotransferase activity. An important paralog of this gene is CEPT1.
Molecular Mass : 71.5 kDa
AA Sequence : MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLSTVFMAVGASIAARLGTYPDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIALVIVFVLSAFGGATMWDYTIPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIMIYKKSATDVFEKHPCLYILMFGCVFAKVSQKLVVAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVVLWMAMVISSFDMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHPT1 choline phosphotransferase 1 [ Homo sapiens ]
Official Symbol CHPT1
Synonyms CHPT1; choline phosphotransferase 1; cholinephosphotransferase 1; CPT1; phosphatidylcholine synthesizing enzyme; hCPT1; AAPT1-like protein; cholinephosphotransferase 1 alpha; diacylglycerol cholinephosphotransferase 1; CPT;
Gene ID 56994
mRNA Refseq NM_020244
Protein Refseq NP_064629
MIM 616747
UniProt ID Q8WUD6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHPT1 Products

Required fields are marked with *

My Review for All CHPT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon