Recombinant Full Length Chicken Cholinephosphotransferase 1(Chpt1) Protein, His-Tagged
Cat.No. : | RFL2500GF |
Product Overview : | Recombinant Full Length Chicken Cholinephosphotransferase 1(CHPT1) Protein (Q5ZHQ5) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MAAPWVLPAPLSPAQLKRLEQHRYSSAGRSLLEPWLQPYWGWLVERLPPWLAPNAITLGG LLLNCLTALPLIASCPTATEQAPFWAYILGALGLFIYQSLDAIDGKQARRTNSSSPLGEL FDHGCDSISTVFVVLGSCIAIRLGTNPDWLFFCCFVGLFMFYSAHWQTYVSGILRFGKVD VTEVQIAITMLLLVSAFCGTAVWDYKVHLVGLELKFFAVVGILCGTAVSCFNYFRIIFGG GVGKNGSTIAVAHMTKSEISLQDTAFIGPGLLFLDQYFNSFIDEYVVLWIALFISLFDML RYATGVCLQIAAHLHIHVFRISSHQAPEQVQNHND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHPT1 |
Synonyms | CHPT1; RCJMB04_34i2; Cholinephosphotransferase 1; Diacylglycerol cholinephosphotransferase 1 |
UniProt ID | Q5ZHQ5 |
◆ Recombinant Proteins | ||
GUCY2C-1503H | Recombinant Human GUCY2C protein, hFc-tagged | +Inquiry |
SPATA17-7234Z | Recombinant Zebrafish SPATA17 | +Inquiry |
SNIP1-692H | Recombinant Human Smad nuclear interacting protein 1, His-tagged | +Inquiry |
C1s-20RFL | Recombinant Full Length Rat complement C1s Protein, His&Myc tagged | +Inquiry |
HA-544H | Recombinant Influenza A H1N1 (A/Albany/12/1951) HA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
F9-300R | Native Rat Factor IX | +Inquiry |
SRC-29697TH | Native Human SRC | +Inquiry |
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45A-575HCL | Recombinant Human GADD45A cell lysate | +Inquiry |
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
REEP6-2425HCL | Recombinant Human REEP6 293 Cell Lysate | +Inquiry |
TAF12-1276HCL | Recombinant Human TAF12 293 Cell Lysate | +Inquiry |
SW480-23HL | Human SW480 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHPT1 Products
Required fields are marked with *
My Review for All CHPT1 Products
Required fields are marked with *
0
Inquiry Basket