Recombinant Full Length Human CHI3L2 Protein, C-Flag-tagged
Cat.No. : | CHI3L2-1554HFL |
Product Overview : | Recombinant Full Length Human CHI3L2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLL SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CHI3L2 chitinase 3 like 2 [ Homo sapiens (human) ] |
Official Symbol | CHI3L2 |
Synonyms | CHIL2; YKL39; YKL-39 |
Gene ID | 1117 |
mRNA Refseq | NM_004000.3 |
Protein Refseq | NP_003991.2 |
MIM | 601526 |
UniProt ID | Q15782 |
◆ Recombinant Proteins | ||
CHI3L2-1177H | Recombinant Human CHI3L2 protein(Met1-Leu390), His-tagged | +Inquiry |
CHI3L2-1674H | Recombinant Human CHI3L2 protein, His & T7-tagged | +Inquiry |
CHI3L2-4412H | Recombinant Human CHI3L2 protein, His-SUMO-tagged | +Inquiry |
CHI3L2-1233H | Recombinant Human CHI3L2 Protein, GST-Tagged | +Inquiry |
CHI3L2-3196HF | Recombinant Full Length Human CHI3L2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHI3L2-2020HCL | Recombinant Human CHI3L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHI3L2 Products
Required fields are marked with *
My Review for All CHI3L2 Products
Required fields are marked with *
0
Inquiry Basket