Recombinant Full Length Human CH25H Protein, GST-tagged
Cat.No. : | CH25H-3305HF |
Product Overview : | Human CH25H full-length ORF (NP_003947.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 272 amino acids |
Description : | This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CH25H cholesterol 25-hydroxylase [ Homo sapiens ] |
Official Symbol | CH25H |
Synonyms | CH25H; cholesterol 25-hydroxylase; h25OH; cholesterol 25-monooxygenase; C25H; |
Gene ID | 9023 |
mRNA Refseq | NM_003956 |
Protein Refseq | NP_003947 |
MIM | 604551 |
UniProt ID | O95992 |
◆ Cell & Tissue Lysates | ||
CH25H-7549HCL | Recombinant Human CH25H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CH25H Products
Required fields are marked with *
My Review for All CH25H Products
Required fields are marked with *
0
Inquiry Basket