Recombinant Full Length Human CES1 Protein, C-Flag-tagged
Cat.No. : | CES1-1145HFL |
Product Overview : | Recombinant Full Length Human CES1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.4 kDa |
AA Sequence : | MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQP AEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIH GGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGG NPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI NKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIR LSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ TEHIELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Drug metabolism - other enzymes |
Full Length : | Full L. |
Gene Name | CES1 carboxylesterase 1 [ Homo sapiens (human) ] |
Official Symbol | CES1 |
Synonyms | CEH; REH; TGH; ACAT; CE-1; CES2; HMSE; SES1; HMSE1; PCE-1; hCE-1 |
Gene ID | 1066 |
mRNA Refseq | NM_001266.5 |
Protein Refseq | NP_001257.4 |
MIM | 114835 |
UniProt ID | P23141 |
◆ Recombinant Proteins | ||
CES1-900H | Recombinant Human CES1, His-tagged | +Inquiry |
CES1-3227M | Recombinant Mouse CES1 protein, His-tagged | +Inquiry |
CES1-1238M | Recombinant Mouse CES1 protein, His-GST-tagged | +Inquiry |
CES1-579H | Recombinant Human CES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CES1-71HF | Recombinant Full Length Human CES1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CES1-7564HCL | Recombinant Human CES1 293 Cell Lysate | +Inquiry |
CES1-7565HCL | Recombinant Human CES1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CES1 Products
Required fields are marked with *
My Review for All CES1 Products
Required fields are marked with *
0
Inquiry Basket