Recombinant Full Length Human CELF1 Protein, GST-tagged

Cat.No. : CELF1-2391HF
Product Overview : Human CUGBP1 full-length ORF ( NP_941989.1, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 483 amino acids
Description : Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 78 kDa
AA Sequence : MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CELF1 CUGBP, Elav-like family member 1 [ Homo sapiens ]
Official Symbol CELF1
Synonyms CELF1; CUGBP, Elav-like family member 1; CUG triplet repeat, RNA binding protein 1 , CUG triplet repeat, RNA binding protein 1 , CUGBP1; CUGBP Elav-like family member 1; bruno like 2; BRUNOL2; CUG RNA binding protein; CUG BP; CUGBP; EDEN BP; embryo deadenylation element binding protein; hNab50; NAB50; NAPOR; nuclear polyadenylated RNA binding protein; 50 kD; CELF-1; CUG-BP1; bruno-like 2; EDEN-BP homolog; bruno-like protein 2; CUG RNA-binding protein; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG-BP- and ETR-3-like factor 1; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; 50 kDa nuclear polyadenylated RNA-binding protein; nuclear polyadenylated RNA-binding protein, 50-kD; embryo deadenylation element-binding protein homolog; CUG-BP; CUGBP1; EDEN-BP;
Gene ID 10658
mRNA Refseq NM_001025596
Protein Refseq NP_001020767
MIM 601074
UniProt ID Q92879

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CELF1 Products

Required fields are marked with *

My Review for All CELF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon