Recombinant Full Length Human CELA1 Protein, GST-tagged

• Cat.No.: CELA1-4306HF
• Product Overview: Human ELA1 full-length ORF ( NP_001962.3, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 258 amino acids
• Description: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]
• Molecular Mass: 54.2 kDa
• AA Sequence: MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CELA1 chymotrypsin like elastase family member 1 [ Homo sapiens (human) ]
• Official Symbol: CELA1
• Synonyms: CELA1; chymotrypsin like elastase family member 1; Chymotrypsin Like Elastase Family Member 1; Elastase 1, Pancreatic; Pancreatic Elastase 1; EC 3.4.21.36; Elastase-1; ELA1; Chymotrypsin-Like Elastase Family, Member 1; Chymotrypsin-Like Elastase Family Member 1; EC 3.4.21; chymotrypsin-like elastase family member 1; elastase 1, pancreatic; elastase-1; pancreatic elastase 1; EC 3.4.21.36
• Gene ID: 1990
• mRNA Refseq: NM_001971
• Protein Refseq: NP_001962
• MIM: 130120
• UniProt ID: Q9UNI1