Recombinant Full Length Human CELA1 Protein, GST-tagged

Cat.No. : CELA1-4306HF
Product Overview : Human ELA1 full-length ORF ( NP_001962.3, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 258 amino acids
Description : Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq, May 2009]
Molecular Mass : 54.2 kDa
AA Sequence : MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CELA1 chymotrypsin like elastase family member 1 [ Homo sapiens (human) ]
Official Symbol CELA1
Synonyms CELA1; chymotrypsin like elastase family member 1; Chymotrypsin Like Elastase Family Member 1; Elastase 1, Pancreatic; Pancreatic Elastase 1; EC 3.4.21.36; Elastase-1; ELA1; Chymotrypsin-Like Elastase Family, Member 1; Chymotrypsin-Like Elastase Family Member 1; EC 3.4.21; chymotrypsin-like elastase family member 1; elastase 1, pancreatic; elastase-1; pancreatic elastase 1; EC 3.4.21.36
Gene ID 1990
mRNA Refseq NM_001971
Protein Refseq NP_001962
MIM 130120
UniProt ID Q9UNI1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CELA1 Products

Required fields are marked with *

My Review for All CELA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon