Recombinant Full Length Human CDX2 Protein, GST-tagged

• Cat.No.: CDX2-3265HF
• Product Overview: Human CDX2 full-length ORF (AAH14461.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 313 amino acids
• Description: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis. [provided by RefSeq, Jan 2012]
• Molecular Mass: 60.17 kDa
• AA Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDX2 caudal type homeobox 2 [ Homo sapiens ]
• Official Symbol: CDX2
• Synonyms: CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2, CDX3; homeobox protein CDX-2; caudal-type homeobox protein 2; caudal type homeobox transcription factor 2; caudal type homeo box transcription factor 2; CDX3; CDX-3
• Gene ID: 1045
• mRNA Refseq: NM_001265
• Protein Refseq: NP_001256
• MIM: 600297
• UniProt ID: Q99626