Recombinant Full Length Human CDKN3 Protein, GST-tagged

Cat.No. : CDKN3-3235HF
Product Overview : Human CDKN3 full-length ORF (AAH64965, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 172 amino acids
Description : The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Molecular Mass : 44.44 kDa
AA Sequence : MKPPSSIQTSCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKN3 cyclin-dependent kinase inhibitor 3 [ Homo sapiens ]
Official Symbol CDKN3
Synonyms CDKN3; cyclin-dependent kinase inhibitor 3; CDI1; CDK2 associated dual specificity phosphatase; cyclin dependent kinase inhibitor; KAP; kinase associated phosphatase; kinase-associated phosphatase; Cdk-associated protein phosphatase; cyclin-dependent kinase interactor 1; CDK2-associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; cyclin-dependent kinase interacting protein 2; cyclin-dependent kinase-interacting protein 2; CIP2; KAP1; FLJ25787; MGC70625;
Gene ID 1033
mRNA Refseq NM_001130851
Protein Refseq NP_001124323
MIM 123832
UniProt ID Q16667

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDKN3 Products

Required fields are marked with *

My Review for All CDKN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon