Recombinant Human CDKN3 Protein (1-212 aa), His-tagged

• Cat.No.: CDKN3-2236H
• Product Overview: Recombinant Human CDKN3 Protein (1-212 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-212 aa
• Description: May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.8 kDa
• AA Sequence: MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CDKN3 cyclin-dependent kinase inhibitor 3 [ Homo sapiens ]
• Official Symbol: CDKN3
• Synonyms: CDKN3; CDI1; KAP; CIP2; KAP1; FLJ25787; MGC70625
• Gene ID: 1033
• mRNA Refseq: NM_001130851
• Protein Refseq: NP_001124323
• MIM: 123832
• UniProt ID: Q16667