Recombinant Human CDKN3 Protein, GST-Tagged

• Cat.No.: CDKN3-1067H
• Product Overview: Human CDKN3 full-length ORF (AAH64965, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
• Molecular Mass: 44.44 kDa
• AA Sequence: MKPPSSIQTSCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKN3 cyclin-dependent kinase inhibitor 3 [ Homo sapiens ]
• Official Symbol: CDKN3
• Synonyms: CDKN3; cyclin-dependent kinase inhibitor 3; CDI1; CDK2 associated dual specificity phosphatase; cyclin dependent kinase inhibitor; KAP; kinase associated phosphatase; kinase-associated phosphatase; Cdk-associated protein phosphatase; cyclin-dependent kinase interactor 1; CDK2-associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; cyclin-dependent kinase interacting protein 2; cyclin-dependent kinase-interacting protein 2; CIP2; KAP1; FLJ25787; MGC70625
• Gene ID: 1033
• mRNA Refseq: NM_001130851
• Protein Refseq: NP_001124323
• MIM: 123832
• UniProt ID: Q16667