Recombinant Full Length Human CDKN2A Protein, C-Flag-tagged
Cat.No. : | CDKN2A-423HFL |
Product Overview : | Recombinant Full Length Human CDKN2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 16.4 kDa |
AA Sequence : | MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEP NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGS NHARIDAAEGPSDIPDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer |
Full Length : | Full L. |
Gene Name | CDKN2A cyclin dependent kinase inhibitor 2A [ Homo sapiens (human) ] |
Official Symbol | CDKN2A |
Synonyms | ARF; MLM; P14; P16; P19; CMM2; INK4; MTS1; TP16; CDK4I; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A |
Gene ID | 1029 |
mRNA Refseq | NM_000077.5 |
Protein Refseq | NP_000068.1 |
MIM | 600160 |
UniProt ID | P42771 |
◆ Recombinant Proteins | ||
CDKN2A-1313R | Recombinant Rat CDKN2A Protein | +Inquiry |
CDKN2A-3720H | Recombinant Human CDKN2A protein, GST-tagged | +Inquiry |
CDKN2A-423HFL | Recombinant Full Length Human CDKN2A Protein, C-Flag-tagged | +Inquiry |
CDKN2A-7704H | Recombinant Human CDKN2A protein, His & T7-tagged | +Inquiry |
Cdkn2a-7705M | Recombinant Mouse Cdkn2a protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2A-7616HCL | Recombinant Human CDKN2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDKN2A Products
Required fields are marked with *
My Review for All CDKN2A Products
Required fields are marked with *
0
Inquiry Basket