Recombinant Human CDKN2A protein, GST-tagged

• Cat.No.: CDKN2A-3720H
• Product Overview: Recombinant Human CDKN2A protein(55-156 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 55-156 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: SARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CDKN2A cyclin-dependent kinase inhibitor 2A [ Homo sapiens ]
• Official Symbol: CDKN2A
• Synonyms: CDKN2A; cyclin-dependent kinase inhibitor 2A; CDKN2, cyclin dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) , MLM; ARF; CDK4I; CMM2; INK4; INK4a; MTS1; p14; p16; p16INK4a; p19; p19Arf; CDK4 inhibitor p16-INK4; multiple tumor suppressor 1; cell cycle negative regulator beta; cyclin-dependent kinase 4 inhibitor A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); MLM; P14; P16; P19; TP16; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A
• Gene ID: 1029
• mRNA Refseq: NM_000077
• Protein Refseq: NP_000068
• MIM: 600160
• UniProt ID: P42771