Recombinant Full Length Human CDKN1B Protein, C-Flag-tagged

Cat.No. : CDKN1B-2041HFL
Product Overview : Recombinant Full Length Human CDKN1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4).
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 21.9 kDa
AA Sequence : MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Cell cycle, Chronic myeloid leukemia, ErbB signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer
Full Length : Full L.
Gene Name CDKN1B cyclin dependent kinase inhibitor 1B [ Homo sapiens (human) ]
Official Symbol CDKN1B
Synonyms KIP1; MEN4; CDKN4; MEN1B; P27KIP1
Gene ID 1027
mRNA Refseq NM_004064.5
Protein Refseq NP_004055.1
MIM 600778
UniProt ID P46527

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDKN1B Products

Required fields are marked with *

My Review for All CDKN1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon