Recombinant Human ABCC6 protein, His-tagged

• Cat.No.: ABCC6-9219H
• Product Overview: Recombinant Human ABCC6 protein(1219-1503 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1219-1503 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ]
• Official Symbol: ABCC6
• Synonyms: ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7; multidrug resistance-associated protein 6; MOAT-E; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein; ARA; PXE; PXE1; ABC34; GACI2; MOATE
• Gene ID: 368
• mRNA Refseq: NM_001079528
• Protein Refseq: NP_001072996
• MIM: 603234
• UniProt ID: O95255