Recombinant Human CDKN1B Protein, GST-Tagged

• Cat.No.: CDKN1B-1056H
• Product Overview: Human CDKN1B full-length ORF (AAH01971, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014]
• Molecular Mass: 47.52 kDa
• AA Sequence: MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKN1B cyclin-dependent kinase inhibitor 1B (p27, Kip1) [ Homo sapiens ]
• Official Symbol: CDKN1B
• Synonyms: CDKN1B; cyclin-dependent kinase inhibitor 1B (p27, Kip1); cyclin-dependent kinase inhibitor 1B; KIP1; P27KIP1; MEN4; CDKN4; MEN1B
• Gene ID: 1027
• mRNA Refseq: NM_004064
• Protein Refseq: NP_004055
• MIM: 600778
• UniProt ID: P46527