Recombinant Full Length Human CDK4 Protein, C-Flag-tagged
Cat.No. : | CDK4-927HFL |
Product Overview : | Recombinant Full Length Human CDK4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRD LKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNP HKRISAFRALQHSYLHKDEGNPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer, T cell receptor signaling pathway, Tight junction |
Full Length : | Full L. |
Gene Name | CDK4 cyclin dependent kinase 4 [ Homo sapiens (human) ] |
Official Symbol | CDK4 |
Synonyms | CMM3; PSK-J3 |
Gene ID | 1019 |
mRNA Refseq | NM_000075.4 |
Protein Refseq | NP_000066.1 |
MIM | 123829 |
UniProt ID | P11802 |
◆ Recombinant Proteins | ||
Cdk4-865M | Recombinant Mouse Cdk4 Protein, MYC/DDK-tagged | +Inquiry |
CDK4-784R | Recombinant Rhesus monkey CDK4 Protein, His-tagged | +Inquiry |
CDK4/CCND3-275H | Recombinant Human CDK4/CCND3, GST-tagged, Active | +Inquiry |
CDK4-633H | Recombinant Human CDK4 Protein, GST-tagged | +Inquiry |
CDK4-1073H | Recombinant Human CDK4 Protein (Met1-Glu303), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK4-664HCL | Recombinant Human CDK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK4 Products
Required fields are marked with *
My Review for All CDK4 Products
Required fields are marked with *
0
Inquiry Basket