Recombinant Full Length Human CD70 Protein, GST-tagged

• Cat.No.: CD70-3055HF
• Product Overview: Human CD70 full-length ORF (AAH00725, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.86 kDa
• Protein length: 193 amino acids
• AA Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD70 CD70 molecule [ Homo sapiens ]
• Official Symbol: CD70
• Synonyms: CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7
• Gene ID: 970
• mRNA Refseq: NM_001252
• Protein Refseq: NP_001243
• MIM: 602840
• UniProt ID: P32970