Recombinant Full Length Human CD300C Protein, GST-tagged

• Cat.No.: CD300C-3111HF
• Product Overview: Human CD300C full-length ORF (AAH22279, 21 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.18 kDa
• Protein length: 21-224 amino acids
• AA Sequence: GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD300C CD300c molecule [ Homo sapiens ]
• Official Symbol: CD300C
• Synonyms: CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leukocyte immunoglobulin-like receptor; CLM-6; CMRF-35; CMRF-35A; CMRF35A1; CMRF35-A1
• Gene ID: 10871
• mRNA Refseq: NM_006678
• Protein Refseq: NP_006669
• MIM: 606786
• UniProt ID: Q08708